DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and Cd5l

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001020856.1 Gene:Cd5l / 310693 RGDID:1308526 Length:346 Species:Rattus norvegicus


Alignment Length:224 Identity:81/224 - (36%)
Similarity:105/224 - (46%) Gaps:43/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSG--FFGPAR--R 121
            :|||||.:..||.:||.|||:||.||||.||..:..:|||:|.. |..:.|.||  :..||.  :
  Rat    27 VRLVGGAHRCEGRVEVKHNGQWGTVCDDGWDLIDVSVVCRELNC-GAAKKTPSGASYHPPASEGQ 90

  Fly   122 RFWMDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVCYPPENALIPMATPIIRDEDLPKYPIH 186
            ...:..:.|.|.|..|..|.. .:...||...|.|||.|..|:|               |:    
  Rat    91 SVLIQGVECSGAEDMLAQCTL-NYDVFDCSHAEDAGVQCENPDN---------------PE---- 135

  Fly   187 SRSRLYVRLRGGRSRIEGRVEVSLDGGRWGSVCADGWSLLEANVVCRQLGLGYASEAFQ-----T 246
                 .|||..|..|.:||:||... |:|.:||..||:|..:.|||||||.|.|..|.:     |
  Rat   136 -----NVRLVEGLGRCQGRLEVFYQ-GQWSTVCKAGWNLQASKVVCRQLGCGRALLAHRCCNKNT 194

  Fly   247 DFFGGFNVSRPV-LSGSECYGNETELADC 274
            ...|      |: :|...|.|.|..|.||
  Rat   195 QGKG------PIWMSKMSCSGREANLQDC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 41/103 (40%)
SRCR 66..160 CDD:278931 37/97 (38%)
SR 193..298 CDD:214555 36/88 (41%)
SRCR 198..298 CDD:278931 33/83 (40%)
Lysyl_oxidase 303..503 CDD:279521
Cd5lNP_001020856.1 SR 27..128 CDD:214555 41/102 (40%)
SRCR 32..128 CDD:278931 37/97 (38%)
SR 137..236 CDD:214555 36/88 (41%)
SRCR 142..236 CDD:278931 33/83 (40%)
SR 242..344 CDD:214555
SRCR 247..344 CDD:278931
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.