DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Loxl2 and SCARA5

DIOPT Version :9

Sequence 1:	NP_523806.2	Gene:	Loxl2 / 37485	FlyBaseID:	FBgn0034660	Length:	511	Species:	Drosophila melanogaster
Sequence 2:	NP_776194.2	Gene:	SCARA5 / 286133	HGNCID:	28701	Length:	495	Species:	Homo sapiens

Alignment Length:	100	Identity:	45/100 - (45%)
Similarity:	59/100 - (59%)	Gaps:	0/100 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    61 IRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRRFWM 125
            ||||.|...:||.:||.|:.:||.||||.||..:.|:|||.|||.|:....|:..||....|.||
Human   393 IRLVNGSGPHEGRVEVYHDRRWGTVCDDGWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWM 457

  Fly   126 DNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVC 160
            |::.|:|.|:.:..|.|..||..:|...|.|.|.|
Human   458 DDVACKGTEETIFRCSFSKWGVTNCGHAEDASVTC 492

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Loxl2	NP_523806.2	SR	61..161	CDD:214555	44/99 (44%)
		SRCR	66..160	CDD:278931	40/93 (43%)
		SR	193..298	CDD:214555
		SRCR	198..298	CDD:278931
		Lysyl_oxidase	303..503	CDD:279521
SCARA5	NP_776194.2	MscS_porin	<89..>191	CDD:403869
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	301..386
		Collagen	318..373	CDD:396114
		SR	393..493	CDD:214555	44/99 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000