DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and Lox

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_058757.1 Gene:Lox / 24914 RGDID:3015 Length:411 Species:Rattus norvegicus


Alignment Length:210 Identity:85/210 - (40%)
Similarity:129/210 - (61%) Gaps:6/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 YIAPDLVVDYLEIEQTAHLEDRPMLLMQCAMEENCVANEAYQIQRDDPHWRYRSRRLLKFTAAAI 364
            |..||||.|...|:.:.:::...|..::||.||||:|:.||:....|    |..|.||:|.....
  Rat   204 YGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRD----YDHRVLLRFPQRVK 264

  Fly   365 NAGNADFRPFKEKSQWEWHMCHMHFHSMEVFATFDIFNL-RGIKVAQGHKASFCLEDSNCLPGVA 428
            |.|.:||.|.:.:..||||.||.|:|||:.|:.:|:.:. ...:||:||||||||||::|..|..
  Rat   265 NQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYH 329

  Fly   429 KKYNCANYGDQGISINCSDVYLYNLDCQWVDVTDLIPGTYVLKIAINPEFKVAEMNYDNNAAICD 493
            :::.|..: .||:|..|.|.|..::||||:|:||:.||.|:||:::||.:.|.|.:|.||...|:
  Rat   330 RRFACTAH-TQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCE 393

  Fly   494 LIYTANFARVQNCQL 508
            :.||.:.|....|.:
  Rat   394 IRYTGHHAYASGCTI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555
SRCR 66..160 CDD:278931
SR 193..298 CDD:214555
SRCR 198..298 CDD:278931
Lysyl_oxidase 303..503 CDD:279521 83/200 (42%)
LoxNP_058757.1 PRK12323 <56..>155 CDD:237057
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..168
Lysyl-oxidase like 207..411 84/207 (41%)
Lysyl_oxidase 207..408 CDD:366506 84/205 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.