| Sequence 1: | NP_523806.2 | Gene: | Loxl2 / 37485 | FlyBaseID: | FBgn0034660 | Length: | 511 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001121618.1 | Gene: | Scart2 / 244234 | MGIID: | 2443685 | Length: | 1112 | Species: | Mus musculus |
| Alignment Length: | 400 | Identity: | 115/400 - (28%) |
|---|---|---|---|
| Similarity: | 147/400 - (36%) | Gaps: | 138/400 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 KVLKMGLTLV-CL----TLLAIHMADAVVQHR-SLEDARQERQRLVHRYTKVLNKEEGAIRLVGG 66
Fly 67 DNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRRFWMDNLFCE 131
Fly 132 GHEQELVDCHFEGWGENDCEPGEAAGVVCYP---------------------------------- 162
Fly 163 -------------PENALI--PMATPII----------RDE------DLPKYPIHSRSRL----- 191
Fly 192 ------------------------------YVRLRGGRSRIEGRVEVSLDGGRWGSVCADGWSLL 226
Fly 227 EANVVCRQLGLGYASEAFQTDFFG-GFNVSRPV-LSGSECYGNETEL----------ADCLH-HD 278
Fly 279 ASQGIISCHG 288 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Loxl2 | NP_523806.2 | SR | 61..161 | CDD:214555 | 46/99 (46%) |
| SRCR | 66..160 | CDD:278931 | 43/93 (46%) | ||
| SR | 193..298 | CDD:214555 | 45/108 (42%) | ||
| SRCR | 198..298 | CDD:278931 | 43/103 (42%) | ||
| Lysyl_oxidase | 303..503 | CDD:279521 | |||
| Scart2 | NP_001121618.1 | SR | 33..130 | CDD:214555 | |
| SRCR | <162..233 | CDD:366150 | |||
| SR | 355..452 | CDD:214555 | |||
| SR | 457..556 | CDD:214555 | |||
| SR | 562..662 | CDD:214555 | 12/41 (29%) | ||
| SR | 667..767 | CDD:214555 | 46/99 (46%) | ||
| SR | 899..999 | CDD:214555 | 44/106 (42%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||