DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and Msr1

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006509374.1 Gene:Msr1 / 20288 MGIID:98257 Length:481 Species:Mus musculus


Alignment Length:57 Identity:24/57 - (42%)
Similarity:34/57 - (59%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFG 117
            :|||||...:||.:|:.|.|:||.:|||.||.....:|||.||:..:....:...||
Mouse   386 VRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFG 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 24/57 (42%)
SRCR 66..160 CDD:278931 20/52 (38%)
SR 193..298 CDD:214555
SRCR 198..298 CDD:278931
Lysyl_oxidase 303..503 CDD:279521
Msr1XP_006509374.1 Tar <147..>304 CDD:223910
Macscav_rec 154..202 CDD:367543
Collagen 306..367 CDD:189968
SR 386..>443 CDD:214555 24/57 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.