DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and DMBT1

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001364459.1 Gene:DMBT1 / 1755 HGNCID:2926 Length:2542 Species:Homo sapiens


Alignment Length:248 Identity:100/248 - (40%)
Similarity:131/248 - (52%) Gaps:16/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AIRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRRFW 124
            |:|||.||...:|.:|:|:.|.||.||||.||:.:|::||||||.........:.:||.......
Human   101 ALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIA 165

  Fly   125 MDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVC--YPPENALIPMATPIIRDEDLPKYPIH- 186
            :|::.|.|||..|..|...||..::|..||.|||:|  ..|::.|.|.:.|:   ...|..|.. 
Human   166 LDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPV---RISPPVPTEG 227

  Fly   187 SRSRLYVRLRGGRSRIEGRVEVSLDGGRWGSVCADGWSLLEANVVCRQLGLGYASEAFQTDFFGG 251
            |.|.|.:||..|..|..||||| |..|.||:||.|.|...:|||||||||.|:|..|.....|| 
Human   228 SESSLALRLVNGGDRCRGRVEV-LYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFG- 290

  Fly   252 FNVSRP-VLSGSECYGNETELADCLHHDASQGIISCHGNRQHVAAVICDYIAP 303
             ..|.| ||....|.|:|:.|..|.|:    |.::.:......|.|||.  ||
Human   291 -QGSGPIVLDDVRCSGHESYLWSCPHN----GWLTHNCGHSEDAGVICS--AP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 42/101 (42%)
SRCR 66..160 CDD:278931 38/93 (41%)
SR 193..298 CDD:214555 44/105 (42%)
SRCR 198..298 CDD:278931 42/100 (42%)
Lysyl_oxidase 303..503 CDD:279521 1/1 (100%)
DMBT1NP_001364459.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..356 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 836..855
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1093..1114
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1222..1243
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1351..1372
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1480..1501
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6689
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.