DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and loxl1

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001096301.1 Gene:loxl1 / 100124878 XenbaseID:XB-GENE-1002050 Length:525 Species:Xenopus tropicalis


Alignment Length:207 Identity:85/207 - (41%)
Similarity:131/207 - (63%) Gaps:6/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 PDLVVDYLEIEQTAHLEDRPMLLMQCAMEENCVANEAYQIQRDDPHWRYRSRRLLKFTAAAINAG 367
            ||||.|...::...:::...:..::||.||:|:::.||..:..|    |..|.||:|.....|.|
 Frog   321 PDLVPDPSYVQAATYIQRAHLYSLKCAAEEHCLSSSAYSAEATD----YDVRVLLRFPQRVKNQG 381

  Fly   368 NADFRPFKEKSQWEWHMCHMHFHSMEVFATFDIFN-LRGIKVAQGHKASFCLEDSNCLPGVAKKY 431
            .|||.|.:.:..||||.||.|:|||:.|:.:|:.: ..|.|||:||||||||||:.|..|..|:|
 Frog   382 TADFLPTRPRQSWEWHSCHQHYHSMDEFSHYDLLDATTGRKVAEGHKASFCLEDTTCDFGNLKRY 446

  Fly   432 NCANYGDQGISINCSDVYLYNLDCQWVDVTDLIPGTYVLKIAINPEFKVAEMNYDNNAAICDLIY 496
            .|.:: .||:|..|.|.|..::||||:|:|::.||.|:||:.:||::||.|.::.||...|::.|
 Frog   447 ACTSH-TQGLSPGCYDTYNADIDCQWIDITEVKPGNYILKVVVNPKYKVLESDFTNNVVRCNIHY 510

  Fly   497 TANFARVQNCQL 508
            |..:|...||::
 Frog   511 TGRYASATNCRI 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555
SRCR 66..160 CDD:278931
SR 193..298 CDD:214555
SRCR 198..298 CDD:278931
Lysyl_oxidase 303..503 CDD:279521 83/200 (42%)
loxl1NP_001096301.1 Lysyl_oxidase 321..521 CDD:307371 84/204 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.