Sequence 1: | NP_523806.2 | Gene: | Loxl2 / 37485 | FlyBaseID: | FBgn0034660 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017212858.1 | Gene: | loxl5b / 100124531 | ZFINID: | ZDB-GENE-070818-3 | Length: | 445 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 93/205 - (45%) |
---|---|---|---|
Similarity: | 132/205 - (64%) | Gaps: | 6/205 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 303 PDLVVDYLEIEQTAHLEDRPMLLMQCAMEENCVANEAYQIQRDDPHWRYRSRRLLKFTAAAINAG 367
Fly 368 NADFRPFKEKSQWEWHMCHMHFHSMEVFATFDIFNL-RGIKVAQGHKASFCLEDSNCLPGVAKKY 431
Fly 432 NCANYGDQGISINCSDVYLYNLDCQWVDVTDLIPGTYVLKIAINPEFKVAEMNYDNNAAICDLIY 496
Fly 497 TANFARVQNC 506 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Loxl2 | NP_523806.2 | SR | 61..161 | CDD:214555 | |
SRCR | 66..160 | CDD:278931 | |||
SR | 193..298 | CDD:214555 | |||
SRCR | 198..298 | CDD:278931 | |||
Lysyl_oxidase | 303..503 | CDD:279521 | 91/200 (46%) | ||
loxl5b | XP_017212858.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D376277at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000389 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45817 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.020 |