DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and FUBP3

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_003925.1 Gene:FUBP3 / 8939 HGNCID:4005 Length:572 Species:Homo sapiens


Alignment Length:115 Identity:32/115 - (27%)
Similarity:50/115 - (43%) Gaps:29/115 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYATG--RIP-----GKELYADVYRQKP 81
            |:.:||.|.     :....|:...|    |:|.:   ||..|  :.|     |.:|.|.|:::  
Human    25 RVRQIAAKI-----DSIPHLNNSTP----LVDPS---VYGYGVQKRPLDDGVGNQLGALVHQR-- 75

  Fly    82 MKIIQKVF-VPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSS 130
             .:|.:.| ||      ....|.|:|..|..:.|:|.|:.|||.:...||
Human    76 -TVITEEFKVP------DKMVGFIIGRGGEQISRIQAESGCKIQIASESS 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 15/46 (33%)
FUBP3NP_003925.1 KH-I 78..148 CDD:412160 16/47 (34%)
KH-I 159..241 CDD:412160
KH-I 252..321 CDD:412160
KH-I 356..424 CDD:412160
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..521
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.