DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and FUBP1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_011540693.1 Gene:FUBP1 / 8880 HGNCID:4004 Length:688 Species:Homo sapiens


Alignment Length:370 Identity:65/370 - (17%)
Similarity:110/370 - (29%) Gaps:164/370 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DRVYATGR-IPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCK 122
            |::...|| .||..     :...|...:|::.:|.::      ||.::|..|.::::|||....|
Human   186 DQIVEKGRPAPGFH-----HGDGPGNAVQEIMIPASK------AGLVIGKGGETIKQLQERAGVK 239

  Fly   123 IALKGRSSMRDRNKEEELR--SDPRYAHLQKNLFLEV-----------------------STVAI 162
            :.:. :...::...::.||  .||......|.:.||:                       ..|.|
Human   240 MVMI-QDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDVPI 303

  Fly   163 PAECHSRIAYAL---------------AEIRKYLIPDNNDEVSHEQLRELMEIDPESAKNFKGLN 212
            |     |.|..:               |.:|....||  |..:.|::.::.. .|:..::...:.
Human   304 P-----RFAVGIVIGRNGEMIKKIQNDAGVRIQFKPD--DGTTPERIAQITG-PPDRCQHAAEII 360

  Fly   213 LEAYRSVRDSN-----------------------GASKYINL-----------------IKRVAE 237
            .:..|||:..|                       |..:..|.                 ||.:::
Human   361 TDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQ 425

  Fly   238 ----------NPSKVAD-----------MEQVDY--------------------DYDEHHMPPIH 261
                      ||...||           .:|:||                    .:..|.:|..|
Human   426 QSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPH 490

  Fly   262 LPTGYEYSIQRPSKIVAKFKRPYPYP-TDMKPVREPPIKFYKPNP 305
            .|.|                 | |.| |.|.|....|   |.|.|
Human   491 GPPG-----------------P-PGPGTPMGPYNPAP---YNPGP 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 28/155 (18%)
FUBP1XP_011540693.1 KH-I 119..193 CDD:412160 1/6 (17%)
KH-I 207..276 CDD:412160 17/75 (23%)
KH-I 297..364 CDD:412160 12/74 (16%)
KH-I 397..468 CDD:412160 10/70 (14%)
DUF1897 623..>643 CDD:401086
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.