DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4021 and KHSRP

DIOPT Version :9

Sequence 1:	NP_611610.2	Gene:	CG4021 / 37484	FlyBaseID:	FBgn0034659	Length:	319	Species:	Drosophila melanogaster
Sequence 2:	NP_001353228.1	Gene:	KHSRP / 8570	HGNCID:	6316	Length:	747	Species:	Homo sapiens

Alignment Length:	62	Identity:	16/62 - (25%)
Similarity:	33/62 - (53%)	Gaps:	9/62 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    85 IQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDP 144
            :|::.:|..:      ||.::|..|.::::|||....|:.|. :...::.|.::.||  .||
Human   235 VQEIMIPAGK------AGLVIGKGGETIKQLQERAGVKMILI-QDGSQNTNVDKPLRIIGDP 289

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4021	NP_611610.2	SF1_like-KH	86..202	CDD:239088	16/61 (26%)
KHSRP	NP_001353228.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..147
		KH-I_FUBP2_rpt1	145..215	CDD:411907
		KH-I_FUBP2_rpt2	233..305	CDD:411910	16/62 (26%)
		KH-I_FUBP2_rpt3	323..390	CDD:411913
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	392..429
		KH-I_FUBP2_rpt4	426..494	CDD:411916
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	497..569
		4 X 12 AA imperfect repeats	571..684
		DUF1897	671..>685	CDD:401086
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D590738at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010