DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and AT5G56140

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_200425.1 Gene:AT5G56140 / 835713 AraportID:AT5G56140 Length:315 Species:Arabidopsis thaliana


Alignment Length:114 Identity:45/114 - (39%)
Similarity:70/114 - (61%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELRSDPRYAHLQK 151
            :|.:||:.||.|||.|::|||:||||:|::..|.|::.::||.|::|..|||.:|..|.|.||.:
plant   169 RVDIPVDNYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNE 233

  Fly   152 NLFLEVSTVAIPAE-CHSRIAYALAEIRKYLIP--DNNDEVSHEQLREL 197
            .|.:.|. ..:|.| ..:|:..|...:...|.|  :.:|....:|||||
plant   234 PLHILVE-AELPIEIVDARLMQAREILDDLLTPMEETHDMYKKQQLREL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 45/114 (39%)
AT5G56140NP_200425.1 STAR_dimer 65..>97 CDD:406848
KH-I 165..265 CDD:412160 38/96 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.