DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and AT4G26480

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001320071.1 Gene:AT4G26480 / 828754 AraportID:AT4G26480 Length:308 Species:Arabidopsis thaliana


Alignment Length:226 Identity:61/226 - (26%)
Similarity:102/226 - (45%) Gaps:51/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QPRLNEIAQKFLADLDEERQRLSAEFP----LCALLIDE-----------------------ARD 59
            ||......:|:|::|..||.:|:...|    :|.|:..|                       |..
plant    51 QPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENALSQSRFDHPSPLASG 115

  Fly    60 RVYATGR---------IPGKELY----ADVYRQKP-------MKIIQKVFVPVNQYPKFNFAGKI 104
            .::...|         .|.:...    |..:...|       :|...:|.:||::||.:||.|::
plant   116 GIFQNSRADMNGWASQFPSERSVSSSPAPNWLNSPGSSSGLIVKRTIRVDIPVDKYPNYNFVGRL 180

  Fly   105 LGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELRSDPRYAHLQKNLFLEVSTVAIPAE-CHS 168
            |||:||||:|::..|.|::.::||.|::|..||:.:|..|.|.||.:.|.:.|. ..:|.| ..:
plant   181 LGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMRGKPGYEHLNEPLHILVE-AELPIEIVDA 244

  Fly   169 RIAYALAEIRKYLIP--DNNDEVSHEQLREL 197
            |:..|...:...|.|  :.:|....:|||||
plant   245 RLMQAREILDDLLTPVEETHDFYKKQQLREL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 43/115 (37%)
AT4G26480NP_001320071.1 STAR_dimer 61..>93 CDD:406848 9/31 (29%)
KH-I 159..259 CDD:412160 37/100 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.