DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and AT3G08620

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_187474.2 Gene:AT3G08620 / 820009 AraportID:AT3G08620 Length:283 Species:Arabidopsis thaliana


Alignment Length:262 Identity:62/262 - (23%)
Similarity:114/262 - (43%) Gaps:66/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NPSEITEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLS---AEFPLCALLIDEARDRVYATGRI 67
            :||.....|..|..      :::..::::.|..|.|:|.   ...|:|:.|:::...|:  ||.:
plant    11 SPSRAASPQIRTPS------SDVDSQYISQLLAEHQKLGPFMQVLPICSRLLNQEIFRI--TGMM 67

  Fly    68 PGKELYADVYRQK---------------------------------------------------- 80
            |.:. :.|..|.:                                                    
plant    68 PNQG-FTDFDRLRHRSPSPMASPNLMSNVSGGGLGGWNGLPPERIGGPHGMAMEWQGAPASPSSY 131

  Fly    81 PMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELRSDPR 145
            |:|.|.::.:||:.||.|||.|::|||:||||:|::..|.|::.::|:.|::|..|||:|:..|.
plant   132 PVKRILRLDLPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLKGKPG 196

  Fly   146 YAHL--QKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRELMEIDPESAKNF 208
            |.||  |.::.:|........:...|.|..:.|.....:.::.|.:..:|||||..::....:|.
plant   197 YEHLNEQLHILIEADLPIDIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLRENS 261

  Fly   209 KG 210
            .|
plant   262 PG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 40/117 (34%)
AT3G08620NP_187474.2 STAR_dimer 28..74 CDD:406848 11/48 (23%)
KH-I 134..234 CDD:412160 36/99 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.