DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and khdrbs2

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001072215.1 Gene:khdrbs2 / 779662 XenbaseID:XB-GENE-490722 Length:345 Species:Xenopus tropicalis


Alignment Length:220 Identity:85/220 - (38%)
Similarity:126/220 - (57%) Gaps:28/220 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QKFLADLDEERQRLSAEFPLCALLIDE--ARDRVYATGRIPGKELYADVYRQKPMKIIQKVFVPV 92
            :|:|.:|..|:..|...|.....|:||  .:.:.....:..|::.|.|:...|.:|:.::|.:||
 Frog     4 EKYLPELMAEKDSLDPSFVHAMRLLDEEIVKFQDSEGNKEDGEKKYLDIISNKNIKLSERVLIPV 68

  Fly    93 NQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDPRYAHLQKNLFL 155
            .|||||||.||:|||:||||:||||||..|:::.|:.||||:.||||||  .:.::|||...|.:
 Frog    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKIKEEELRKSDEAKHAHLSDELHV 133

  Fly   156 EVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRELMEI----DPESAKNFKGLNLEAY 216
            .:...|.|.|.:||:::||.||:|:|:||.|||:..||||||..:    |.|..|..:|..:   
 Frog   134 LLEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSDDSERGKGTRGRGI--- 195

  Fly   217 RSVRDSNGASKYINLIKRVAENPSK 241
                             ||...||:
 Frog   196 -----------------RVPSTPSR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 63/121 (52%)
khdrbs2NP_001072215.1 Qua1 5..57 CDD:374463 12/51 (24%)
SF1_like-KH 61..180 CDD:239088 63/118 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..224 8/46 (17%)
Sam68-YY 263..317 CDD:374636
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10668
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.