DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and khdrbs2

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001070758.1 Gene:khdrbs2 / 768147 ZFINID:ZDB-GENE-061013-497 Length:346 Species:Danio rerio


Alignment Length:212 Identity:87/212 - (41%)
Similarity:128/212 - (60%) Gaps:22/212 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KFLADLDEERQRLSAEFPLCALLIDEARDRVYATGRIPGKEL--------YADVYRQKPMKIIQK 87
            |:|.:|..|::.|.|.|.....|:.|..:      :..|.||        |.|:...|.:|:.::
Zfish     5 KYLPELVAEKESLDASFVHAMRLLAEEIE------KFEGDELRKDGEVKKYLDIISNKNIKLSER 63

  Fly    88 VFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDPRYAHLQ 150
            |.:||.|||||||.||:|||:|||::||||||..|:::.|:.||||:.||||||  .:.:||||.
Zfish    64 VLIPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLS 128

  Fly   151 KNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRELMEI----DPESAKNF--K 209
            .:|.:.:...|.|.|.:||:::||.||:|:|:||.|||:..||||||..:    ||...::.  :
Zfish   129 NDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSDDPSRGRSARGR 193

  Fly   210 GLNLEAYRSVRDSNGAS 226
            ||.|.:..|.|....|:
Zfish   194 GLRLTSTASPRGRGSAA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 63/121 (52%)
khdrbs2NP_001070758.1 Qua1 6..57 CDD:292891 13/56 (23%)
SF1_like-KH 61..180 CDD:239088 63/118 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..292 9/36 (25%)
Sam68-YY <281..>306 CDD:293176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590100
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.