DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and SF1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001365886.1 Gene:SF1 / 7536 HGNCID:12950 Length:764 Species:Homo sapiens


Alignment Length:323 Identity:70/323 - (21%)
Similarity:129/323 - (39%) Gaps:73/323 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKMENPSEI--TEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYAT 64
            ::..:|..|  :|.:...|.|::.|         ..|:|||..|..|  :.||            
Human   203 DRSPSPEPIYNSEGKRLNTREFRTR---------KKLEEERHNLITE--MVAL------------ 244

  Fly    65 GRIPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRS 129
              .|..:..|| |:....::..||.:|.::||:.||.|.::||:||:|:.:::|...||.::|:.
Human   245 --NPDFKPPAD-YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKG 306

  Fly   130 SMRD----RNKEEELRSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYL-----IPDN 185
            |:::    |...:.|..:....|           ..:.|.....:..|:.:||..|     .|::
Human   307 SVKEGKVGRKDGQMLPGEDEPLH-----------ALVTANTMENVKKAVEQIRNILKQGIETPED 360

  Fly   186 NDEVSHEQLRELMEID----PESAKNFKGLNLEAYRSVRDS------NGASKYINLIK-RVAENP 239
            .:::...|||||..::    .:..:..:.......||:.::      .||....:..| :...:|
Human   361 QNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP 425

  Fly   240 SKVADMEQVDYDY----DEHHMPPIHLPTGYEYSIQRPSKI-VAKFKRPYPYPTDMKPVREPP 297
            ....|..::|.:|    .|....|:....|   |...|:.. :|...||      ..|...||
Human   426 QSAQDKARMDKEYLSLMAELGEAPVPASVG---STSGPATTPLASAPRP------AAPANNPP 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 32/128 (25%)
SF1NP_001365886.1 MSL5 142..382 CDD:227503 50/215 (23%)
ZnF_C2HC 403..418 CDD:197667 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.