DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and Khdrbs3

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_071585.2 Gene:Khdrbs3 / 64015 RGDID:620921 Length:346 Species:Rattus norvegicus


Alignment Length:170 Identity:78/170 - (45%)
Similarity:112/170 - (65%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QKFLADLDEERQRLSAEFPLCALLIDEARDRVYATGRIPGKELYADVYRQKPMKIIQKVFVPVNQ 94
            :|:|.:|..|:..|...|.....|::...:: :..|....:|.|.||...|.||:.|||.:||.|
  Rat     3 EKYLPELMAEKDSLDPSFTHALRLVNREIEK-FQKGEAKDEEKYIDVVINKNMKLGQKVLIPVKQ 66

  Fly    95 YPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDPRYAHLQKNLFLEV 157
            :|||||.||:|||:||||:||||||..|:::.|:.||||:.||||||  .:.:|.||..:|.:.:
  Rat    67 FPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLI 131

  Fly   158 STVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLREL 197
            ...|.|||.::|:.:||.||:|:||||.|||:...||:||
  Rat   132 EVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQEL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 63/114 (55%)
Khdrbs3NP_071585.2 Involved in homodimerization. /evidence=ECO:0000250|UniProtKB:O75525 1..160 71/157 (45%)
Qua1 4..53 CDD:406639 12/49 (24%)
KH-I_KHDRBS3 48..160 CDD:411898 60/111 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..268
Sam68-YY 266..320 CDD:406871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348922
Domainoid 1 1.000 54 1.000 Domainoid score I10913
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4063
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8931
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.