DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and khsrp

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001082897.2 Gene:khsrp / 573145 ZFINID:ZDB-GENE-030131-4357 Length:666 Species:Danio rerio


Alignment Length:75 Identity:18/75 - (24%)
Similarity:37/75 - (49%) Gaps:9/75 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDPRYA 147
            :|::.:|..:      ||.|:|..|.::::|||....|:.|. :.:.:..|.::.||  .||...
Zfish   194 MQEMVIPAGK------AGLIIGKGGETIKQLQERAGVKMILI-QDASQGPNMDKPLRIIGDPYKV 251

  Fly   148 HLQKNLFLEV 157
            ...:.:..|:
Zfish   252 QQAREMVQEI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 18/74 (24%)
khsrpNP_001082897.2 KH_1 108..172 CDD:306517
KH_1 195..260 CDD:306517 17/71 (24%)
KH_1 296..359 CDD:306517
KH_1 404..471 CDD:306517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.