DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and sf1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_009301350.1 Gene:sf1 / 572785 ZFINID:ZDB-GENE-030131-2492 Length:663 Species:Danio rerio


Alignment Length:373 Identity:73/373 - (19%)
Similarity:135/373 - (36%) Gaps:116/373 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKMENPSEI--TEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYAT 64
            ::..:|..|  :|.:...|.||:.|         ..|:|||..|..|.                .
Zfish   150 DRSPSPEPIYNSEGKRLNTREYRTR---------KKLEEERHSLITEM----------------V 189

  Fly    65 GRIPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRS 129
            |..|..:..|| |:....::..||.:|.::||:.||.|.::||:||:|:.:::|...||.::|:.
Zfish   190 GLNPEFKPPAD-YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKG 253

  Fly   130 SMRD----RNKEEELRSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYL-----IPDN 185
            |:::    |...:.|..:....|           ..:.|.....:..|:.:||..|     .|::
Zfish   254 SVKEGKVGRKDGQMLPGEDEPLH-----------ALVTANTMENVKKAVEQIRNILKQGIETPED 307

  Fly   186 NDEVSHEQLRELMEID----PESAKNFKGLNLEAYRSVRDSN-----GASKYI--------NLIK 233
            .:::...|||||..::    .:..:..:.......||:.::.     |.:.:|        :...
Zfish   308 QNDLRKMQLRELARLNGTLREDDNRILRPWQSTEPRSITNTTLCTKCGGAGHISSDCKFTSSFAP 372

  Fly   234 RVAENPSKVADMEQVDYDY-------------------------------DEHHMPPIHLP---- 263
            |..|.|....|..::|.:|                               ..::.||.:.|    
Zfish   373 RPGEPPQSAQDKARMDKEYLSLMAELGEAPVPSSGGGHNNAPPSGPRPSGPNNNQPPPNRPPWMN 437

  Fly   264 ------TGYEYSIQRPSKIVAKFKRPYPYPTDMKPVREPPIKFYKPNP 305
                  ..:....|.|.       .|:.:|..|..:..||:   .|||
Zfish   438 SGPTDNRNFHGMHQGPG-------GPHNFPPPMPNMGGPPM---PPNP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 32/128 (25%)
sf1XP_009301350.1 SF1-HH 90..202 CDD:292892 17/77 (22%)
SF1_like-KH 209..327 CDD:239088 32/128 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.