DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and khdrbs1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001017045.1 Gene:khdrbs1 / 549799 XenbaseID:XB-GENE-479347 Length:360 Species:Xenopus tropicalis


Alignment Length:196 Identity:73/196 - (37%)
Similarity:118/196 - (60%) Gaps:16/196 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYATG--RIPGKELYADVYRQKPMKIIQKVF 89
            |...|:|.:|..|:..|...|.....|:.:..:|:...|  :...::.|.|::..|.||:.:::.
 Frog     2 ETETKYLPELMAEKDSLDPSFTHAMSLLGKEIERLKKGGDAKKDEEDTYLDLFSHKNMKLKERIL 66

  Fly    90 VPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDPRYAHLQKN 152
            :||..||||||.||||||:||:::||||||..||::.|:.||||:.||||||  .||:|:||..:
 Frog    67 IPVKLYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYSHLNMD 131

  Fly   153 LFLEVSTVAIPAECHSRIAYALAEIRKYLIP---------DNNDEVSHEQLRELMEID---PESA 205
            |.:.:.....|.|.::|:|:|:.|::|:|:|         |..|::..||..||..::   ||.:
 Frog   132 LHVFIEVFGPPCESYTRMAHAMEEVKKFLVPLTPESFSYQDMMDDICQEQFMELSYLNGAPPEQS 196

  Fly   206 K 206
            :
 Frog   197 R 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 56/129 (43%)
khdrbs1NP_001017045.1 Qua1 6..58 CDD:406639 11/51 (22%)
KH-I 57..162 CDD:412160 52/104 (50%)
Sam68-YY 282..331 CDD:406871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.