DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and Fubp1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006501723.1 Gene:Fubp1 / 51886 MGIID:1196294 Length:687 Species:Mus musculus


Alignment Length:102 Identity:23/102 - (22%)
Similarity:47/102 - (46%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DRVYATGR-IPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCK 122
            |::...|| .||..     :...|...:|::.:|.::      ||.::|..|.::::|||....|
Mouse   182 DQIVEKGRPAPGFH-----HGDGPGNAVQEIMIPASK------AGLVIGKGGETIKQLQERAGVK 235

  Fly   123 IALKGRSSMRDRNKEEELR--SDPRYAHLQKNLFLEV 157
            :.:. :...::...::.||  .||......|.:.||:
Mouse   236 MVMI-QDGPQNTGADKPLRITGDPYKVQQAKEMVLEL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 17/74 (23%)
Fubp1XP_006501723.1 KH-I 119..181 CDD:238053
KH_1 205..270 CDD:365809 15/71 (21%)
KH-I 295..356 CDD:238053
KH_1 398..462 CDD:365809
DUF1897 628..>642 CDD:370237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.