DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and Qk

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_038942853.1 Gene:Qk / 499022 RGDID:1584886 Length:341 Species:Rattus norvegicus


Alignment Length:361 Identity:89/361 - (24%)
Similarity:145/361 - (40%) Gaps:108/361 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCAL------LIDEARDRVYATGRIPG 69
            |:|:|..|.:|           |..|..:::.:|:....|.:      |:||...||       .
  Rat     7 TKEKPKPTPDY-----------LMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRV-------R 53

  Fly    70 KELYADVYRQKPMK-----------IIQ---KVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQ 120
            |::|.|.......|           |:|   |::|||.:||.|||.|:||||:|.:.::|:.||.
  Rat    54 KDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETG 118

  Fly   121 CKIALKGRSSMRDRNKEEELRSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIP-- 183
            |||.::|:.||||:.|||:.|..|.:.||.::|.:.::..........::..|:.|::|.|:|  
  Rat   119 CKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAA 183

  Fly   184 DNNDEVSHEQLRELMEIDPESAKNFKGLNLEAYRSVRDSNGASKYI--------NLIKRVAENPS 240
            :..|.:...||.||..::               .:.||:|..|..:        ....|:...|:
  Rat   184 EGEDSLKKMQLMELAILN---------------GTYRDANIKSPALAFSLAATAQAAPRIITGPA 233

  Fly   241 KVADMEQVDYDYDEHHMPPIHL----------------------PTGYEY---SIQRPSKIVAKF 280
            .|              :||..|                      |.|..:   :|..|.......
  Rat   234 PV--------------LPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLI 284

  Fly   281 KRPYPYPTDMKP---VREPPIKFYKPNPGIGTYVMK 313
            ..||.||..:.|   :.|.||   :|:..:|....|
  Rat   285 YTPYEYPYTLAPATSILEYPI---EPSGVLGAVATK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 45/120 (38%)
QkXP_038942853.1 STAR_dimer 10..66 CDD:406848 15/73 (21%)
KH-I_Hqk 81..183 CDD:411893 40/101 (40%)
PHA03247 <211..314 CDD:223021 21/119 (18%)
Quaking_NLS 312..341 CDD:406855 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.