DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and nsr

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster


Alignment Length:318 Identity:227/318 - (71%)
Similarity:252/318 - (79%) Gaps:16/318 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MENPSEITEE----QPTTTH-EYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYA 63
            ||..||.|||    |||... .|||||||:||||||||||||:|||||||||||||||:.|||::
  Fly     1 METQSEFTEEQNQDQPTQDQPTYQPRLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFS 65

  Fly    64 TGRIPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGR 128
            ||||||||.|||||.|:||||.||||||||::||||||.|||||||||:|||:|||.|||.:|||
  Fly    66 TGRIPGKEFYADVYHQRPMKITQKVFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGR 130

  Fly   129 SSMRDRNKEEELRS--DPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSH 191
            ||||||||||||||  |||||||.|:||||||.||.||||::||||||||||||||||:||:|.|
  Fly   131 SSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWH 195

  Fly   192 EQLRELMEIDPESAKNFKGLNLEAYRSVRDS------NGASKYINLIKRVAENPSKVADMEQVDY 250
            ||.|||||::|||||...|||:..|||:.|.      |||.||.|.|:||.|||.:|||||:|:|
  Fly   196 EQQRELMEMNPESAKKSNGLNMAPYRSIFDKTIGGNRNGAPKYNNQIRRVTENPREVADMEEVEY 260

  Fly   251 DYDEHHMPPIHLPTGYEYSIQRPSKIVAK---FKRPYPYPTDMKPVREPPIKFYKPNP 305
            |||||.|||.....|:|||...||.....   |||.|||||||...||||||.|||||
  Fly   261 DYDEHRMPPSRPSLGFEYSKPPPSMTATNATPFKRAYPYPTDMNRTREPPIKSYKPNP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 96/117 (82%)
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 96/118 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468735
Domainoid 1 1.000 98 1.000 Domainoid score I7099
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.