DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and CG10384

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster


Alignment Length:192 Identity:92/192 - (47%)
Similarity:124/192 - (64%) Gaps:25/192 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEE 139
            |:.|.||:|:..||.|||..:|||||.||:|||||||::||||:|.||:|:.||.|||||.||||
  Fly    25 DITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEE 89

  Fly   140 LR--SDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRELMEIDP 202
            ||  .|.|||||.::|.:|:||.|.|||.|:||||||||:|::|:||.:|::..||:.|:..:..
  Fly    90 LRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVPDYHDDIRQEQMWEMQALTS 154

  Fly   203 ESAKNFKGLNLEAYRSVRDSNGASKYINLIKRV--AENPSK-----------VADMEQVDYD 251
            ..|       |.|: |:.||:  |..||...:|  ..|.|.           :|||:..:.|
  Fly   155 TPA-------LGAH-SLEDSH--SPTINSSSQVGGTTNSSSNGASGRGLGGGLADMDTSNDD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 71/117 (61%)
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 66/110 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468757
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.