DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and qkr58E-2

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster


Alignment Length:231 Identity:115/231 - (49%)
Similarity:151/231 - (65%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PSEITEEQPTTTHEYQPRLN---------EIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVY 62
            |:.::.......||.:...|         ...||::.:|..||.|:...|||...|||||.:||.
  Fly    42 PTGVSGGTSNGEHENEHNANADGEKAQPAPAVQKYMQELMTERSRMENHFPLAVKLIDEALERVQ 106

  Fly    63 ATGRIPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKG 127
            ..||||.::.|||||:|:.:|:.|||.||:.. .|||:.||:|||||||||||||||||||.:.|
  Fly   107 LNGRIPTRDQYADVYQQRTIKLSQKVHVPIKD-KKFNYVGKLLGPKGNSLRRLQEETQCKIVILG 170

  Fly   128 RSSMRDRNKEEELR--SDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVS 190
            |.||:||.:|||||  :|.:||||...|.:||||:|.|||.::|:||||||||:||.||.:|::.
  Fly   171 RFSMKDRAREEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIR 235

  Fly   191 HEQLRELMEIDPESAKNFKGLNLEAYRSVRDSNGAS 226
            .||.||||| |||:||......|:     :.||.|:
  Fly   236 QEQYRELME-DPEAAKKLTLRQLQ-----QQSNAAA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 75/117 (64%)
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 73/115 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468739
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.