DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and qkr58E-1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster


Alignment Length:334 Identity:121/334 - (36%)
Similarity:189/334 - (56%) Gaps:44/334 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TTTH---EYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYATGRIPGKELYADVY 77
            ||:|   ...|:|||....:|.:...|::.|..:..:...|:|:..:::..:||||..|:||:||
  Fly    42 TTSHAALRDTPQLNEKTNAYLQECLLEKKTLEKKHIITKRLLDDEVEKILVSGRIPKPEIYANVY 106

  Fly    78 RQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELRS 142
            .:||:::.|||..|:.:||||||.|||||||||:||:|||||.||:.:.||:||||..|||||||
  Fly   107 SEKPIRVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRS 171

  Fly   143 --DPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRE------LME 199
              :|:||||.::|.:|:||||.|||.:.||:|||.||||::|||.||::..|||||      :.:
  Fly   172 SGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIPDANDDIRLEQLREMDGKERMYK 236

  Fly   200 IDPESAKNFKGLNLEAYRSVRDSNGASKYINLIKR---VAENPS-------KVADMEQVDY--DY 252
            .....:|::......:.|:...::...|..:::::   |.::|:       :..|.|..|:  :|
  Fly   237 KSHHYSKSYGDHGAYSSRTPPPASSKPKVYSILEKARYVMDDPNYGIVKTHRSRDHELYDHHGEY 301

  Fly   253 DEHHMPPIHLPTGYEYSIQRPSKIVAKFKRPY---------------PYPTDMKPVREPPIKFYK 302
            |.:..||   |...::|........:.::|.|               .||.  ||........|:
  Fly   302 DRYATPP---PQTSKHSTHHAQYDSSSYERDYRREYHPHSSSSSYAAAYPA--KPSNGRSSSSYR 361

  Fly   303 P-NPGIGTY 310
            | ..|.|::
  Fly   362 PTTSGSGSH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 74/123 (60%)
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 64/100 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468745
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
Isobase 1 0.950 - 0 Normalized mean entropy S1833
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.