DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and qkr54B

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster


Alignment Length:266 Identity:119/266 - (44%)
Similarity:166/266 - (62%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYATGRIPGKE-LYADVYRQKPMKIIQK 87
            ::||.|.:::.|...||.|:..:||:...|::...::|..|||||.:| .|||:||:||::|.|:
  Fly    60 QINEKANEYIRDCMAERNRMDRKFPIAEKLLEGEIEKVQTTGRIPSREQKYADIYREKPLRISQR 124

  Fly    88 VFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELRS--DPRYAHLQ 150
            |.||:.::|||||.||:|||||||||||||||.||:.:.||:|||||.|||||||  ||:||||.
  Fly   125 VLVPIREHPKFNFVGKLLGPKGNSLRRLQEETLCKMTVLGRNSMRDRVKEEELRSSKDPKYAHLN 189

  Fly   151 KNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRELMEI----DPESAKNFKGL 211
            .:|.:|:||:|.|||.::|||||:||:|||||||:||.:..|||||||:.    |.::||:    
  Fly   190 SDLHVEISTIAPPAEAYARIAYAMAELRKYLIPDSNDIIRQEQLRELMDSTSLNDNDNAKS---- 250

  Fly   212 NLEAYRSVRDSNGASKY-----INLIKRVAENPSKVADMEQVDYDYDEHHMPPIHLPTGYEYSIQ 271
               .|:......|.:..     ||.|..|...|               ||......|:.:..::.
  Fly   251 ---GYKKTSHMQGGNNVLGGGSINPIGGVKNTP---------------HHSYRSSQPSSFSKNVL 297

  Fly   272 RPSKIV 277
            .|.:.|
  Fly   298 APKQKV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 79/121 (65%)
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 19/48 (40%)
SF1_like-KH 122..237 CDD:239088 77/114 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468750
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3911
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.