powered by:
Protein Alignment CG4021 and Psi
DIOPT Version :9
Sequence 1: | NP_611610.2 |
Gene: | CG4021 / 37484 |
FlyBaseID: | FBgn0034659 |
Length: | 319 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_995862.1 |
Gene: | Psi / 36889 |
FlyBaseID: | FBgn0014870 |
Length: | 797 |
Species: | Drosophila melanogaster |
Alignment Length: | 50 |
Identity: | 16/50 - (32%) |
Similarity: | 28/50 - (56%) |
Gaps: | 8/50 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 KVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIA-LKGRS-SMRDR 134
:||||... .|.::|..|:.:|::|.|..||:. ::|:: .|.||
Fly 319 EVFVPKIA------VGVVIGKGGDMIRKIQTECGCKLQFIQGKNDEMGDR 362
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D590738at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.