DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4021 and Psi

DIOPT Version :9

Sequence 1:	NP_611610.2	Gene:	CG4021 / 37484	FlyBaseID:	FBgn0034659	Length:	319	Species:	Drosophila melanogaster
Sequence 2:	NP_995862.1	Gene:	Psi / 36889	FlyBaseID:	FBgn0014870	Length:	797	Species:	Drosophila melanogaster

Alignment Length:	50	Identity:	16/50 - (32%)
Similarity:	28/50 - (56%)	Gaps:	8/50 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    87 KVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIA-LKGRS-SMRDR 134
            :||||...      .|.::|..|:.:|::|.|..||:. ::|:: .|.||
  Fly   319 EVFVPKIA------VGVVIGKGGDMIRKIQTECGCKLQFIQGKNDEMGDR 362

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4021	NP_611610.2	SF1_like-KH	86..202	CDD:239088	15/49 (31%)
Psi	NP_995862.1	KH	120..185	CDD:197652
		KH_1	214..276	CDD:278442
		KH-I	317..380	CDD:238053	15/49 (31%)
		KH_1	428..491	CDD:278442
		DUF1897	591..619	CDD:286140
		DUF1897	<653..680	CDD:286140
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D590738at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.010