DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and Fubp3

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006233983.1 Gene:Fubp3 / 362106 RGDID:1307004 Length:575 Species:Rattus norvegicus


Alignment Length:126 Identity:24/126 - (19%)
Similarity:52/126 - (41%) Gaps:35/126 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EERQRLSAEFPLCALLIDEARDRVYATGRIPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAG 102
            |:.:||..:      ::|..|:         |...:.|:   .....||::.:|.::      .|
  Rat   135 EQAKRLLGQ------IVDRCRN---------GPGFHNDI---DGNSTIQELLIPASK------VG 175

  Fly   103 KILGPKGNSLRRLQEETQCKIALKGRSSMRD------RNKEEELRSDPRYAHLQKNLFLEV 157
            .::|..|.::::|||.|..|:.:     ::|      .:|...:..||......:.:.||:
  Rat   176 LVIGKGGETIKQLQERTGVKMVM-----IQDGPLPTGADKPLRITGDPFKVQQAREMVLEI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 16/78 (21%)
Fubp3XP_006233983.1 KH-I 79..141 CDD:238053 2/5 (40%)
KH 161..232 CDD:197652 17/82 (21%)
KH-I 255..317 CDD:238053
KH-I 356..421 CDD:238053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.