DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and qkia

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_571299.1 Gene:qkia / 30471 ZFINID:ZDB-GENE-990415-230 Length:383 Species:Danio rerio


Alignment Length:349 Identity:89/349 - (25%)
Similarity:156/349 - (44%) Gaps:87/349 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCAL------LIDEARDRVYATGRIPGK 70
            :|:|..:.:|           |..|..|::.:::...||.:      |:||..:||       .|
Zfish     9 KERPRPSPDY-----------LMQLLNEKKLMTSLPNLCGIFTHLERLLDEEINRV-------RK 55

  Fly    71 ELYAD----VYRQKPMK----------IIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQC 121
            ::|.|    :..:.|::          :.:|:||||.:||.:||.|:||||:|.:.::|:.||.|
Zfish    56 DMYNDSVNGLVDKHPLELPEPVGPIVHLQEKLFVPVKEYPDYNFVGRILGPRGLTAKQLEAETGC 120

  Fly   122 KIALKGRSSMRDRNKEEELRSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIP--D 184
            ||.::|||||||:.|||:.|..|.:.||.::|.:.::..........::..|:.|::|.|:|  :
Zfish   121 KIMVRGRSSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDTQTRAEIKMRRAVEEVKKLLVPAAE 185

  Fly   185 NNDEVSHEQLRELMEIDPESAKNFKGLNLEAYRSVRDSNGASKYINLIKRVAENPSKVADMEQVD 249
            ..|.:...||.||..::    ..::..|::|.........|:......:.:|..|.:|       
Zfish   186 GEDNLKKMQLMELAILN----GTYRDTNIKAPTLAFSLAAAAAAAQGPRLIAAPPGQV------- 239

  Fly   250 YDYDEHHMPPIHL----PTGYE-YSIQRPSKIVAK------------------FKRPYPYPTDMK 291
                   :||..|    |.|.. .:|.||:::...                  :..||.||..:.
Zfish   240 -------LPPATLRPPTPAGTPIMNIIRPTQMATVLPNGTPTLVPPTPDAGIIYTTPYDYPYALA 297

  Fly   292 P--VREPPIK----FYKPNPGIGT 309
            |  :.|.||:    ..|...|:||
Zfish   298 PTSLLEYPIEHSGVLGKRAWGLGT 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 46/117 (39%)
qkiaNP_571299.1 STAR_dimer 11..69 CDD:293152 15/75 (20%)
SF1_like-KH 84..206 CDD:239088 46/125 (37%)
Quaking_NLS 356..383 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.