DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and khdrbs1a

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_571000.1 Gene:khdrbs1a / 30082 ZFINID:ZDB-GENE-000210-25 Length:370 Species:Danio rerio


Alignment Length:186 Identity:71/186 - (38%)
Similarity:114/186 - (61%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KFLADLDEERQRLSAEFPLCALLIDEARDRVYATGRIPGKELYADVYRQKPMKIIQKVFVPVNQY 95
            |:|.:|..|:..|.:.|.....|:....:||.........|||.|::..|.:::.::|.:||.||
Zfish    16 KYLPELLAEKDSLDSSFTHAMKLLSAEIERVQKGEPKKDSELYLDLFASKSVRVKERVLIPVKQY 80

  Fly    96 PKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDPRYAHLQKNLFLEVS 158
            |:|||.||||||:|::::||||:|..||::.|:.||||:|||||||  .||:||||...|.:.:.
Zfish    81 PRFNFVGKILGPQGSTIKRLQEDTGAKISVLGKGSMRDKNKEEELRKGGDPKYAHLGMELHVHIE 145

  Fly   159 TVAIPAECHSRIAYALAEIRKYLIP-DNNDEVSHEQLRELMEIDP---ESAKNFKG 210
            ..|...:|:.|:|:|:.|::|:|:| :..||:..:..     :||   ..|::..|
Zfish   146 VFAPIPDCYLRMAHAMDEVKKFLMPVEGMDEMHPDAF-----MDPGFLNGAQDMSG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 53/118 (45%)
khdrbs1aNP_571000.1 Qua1 17..65 CDD:292891 12/47 (26%)
SF1_like-KH 70..190 CDD:239088 55/124 (44%)
Sam68-YY 289..340 CDD:293176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590119
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.