DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and Sf1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001104261.1 Gene:Sf1 / 22668 MGIID:1095403 Length:639 Species:Mus musculus


Alignment Length:211 Identity:50/211 - (23%)
Similarity:94/211 - (44%) Gaps:48/211 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKMENPSEI--TEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYAT 64
            ::..:|..|  :|.:...|.|::.|         ..|:|||..|..|  :.||            
Mouse    78 DRSPSPEPIYNSEGKRLNTREFRTR---------KKLEEERHTLITE--MVAL------------ 119

  Fly    65 GRIPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRS 129
              .|..:..|| |:....::..||.:|.::||:.||.|.::||:||:|:.:::|...||.::|:.
Mouse   120 --NPDFKPPAD-YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKG 181

  Fly   130 SMRD----RNKEEELRSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYL-----IPDN 185
            |:::    |...:.|..:....|           ..:.|.....:..|:.:||..|     .|::
Mouse   182 SVKEGKVGRKDGQMLPGEDEPLH-----------ALVTANTMENVKKAVEQIRNILKQGIETPED 235

  Fly   186 NDEVSHEQLRELMEID 201
            .:::...|||||..::
Mouse   236 QNDLRKMQLRELARLN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 32/125 (26%)
Sf1NP_001104261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Nuclear localization signal. /evidence=ECO:0000255 15..19
MSL5 17..257 CDD:227503 50/211 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..94 3/15 (20%)
ZnF_C2HC 278..293 CDD:197667
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.