DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and KHDRBS2

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_016865823.1 Gene:KHDRBS2 / 202559 HGNCID:18114 Length:413 Species:Homo sapiens


Alignment Length:172 Identity:79/172 - (45%)
Similarity:115/172 - (66%) Gaps:4/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QKFLADLDEERQRLSAEFPLCALLIDEARDRVYAT-GRIPGKE-LYADVYRQKPMKIIQKVFVPV 92
            :|:|.:|..|:..|...|...:.|:.|..::...: |:...:| .|.||...|.:|:.::|.:||
Human     4 EKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPV 68

  Fly    93 NQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDPRYAHLQKNLFL 155
            .|||||||.||:|||:||||:||||||..|:::.|:.||||:.||||||  .:.:||||...|.:
Human    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHV 133

  Fly   156 EVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLREL 197
            .:...|.|.|.:||:::||.||:|:|:||.|||:..||||||
Human   134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLREL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 64/114 (56%)
KHDRBS2XP_016865823.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155056
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8456
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.