DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and asd-2

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001250340.1 Gene:asd-2 / 188703 WormBaseID:WBGene00006423 Length:486 Species:Caenorhabditis elegans


Alignment Length:213 Identity:63/213 - (29%)
Similarity:109/213 - (51%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EIAQKFLADLDEERQRLSAEFP----LCALLIDEARDRVYA----------TGRIPGKELYADVY 77
            :.:.::|:.|.:::::|:| ||    ....|.||..::|..          :..:|..|..:.|:
 Worm    97 QYSAEYLSQLLKDKKQLAA-FPNVFHHLERLADEEINKVRVVLFQCEFSKESAPLPDAEGDSTVH 160

  Fly    78 RQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELRS 142
                   .:|||||..::|.:||.|:||||:|.:.::|::||.|||.::||.||||:.|||..|.
 Worm   161 -------TEKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRG 218

  Fly   143 DPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLI--PDNNDEVSHEQLRELMEIDPESA 205
            .|.:.||.:.|.:.:...........::..|:.|:||.|:  |:..|::..:||.||..|:    
 Worm   219 KPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLLVPAPEGEDDLKRKQLMELAIIN---- 279

  Fly   206 KNFKGLNLEAYRSVRDSN 223
                    ..|||..|.:
 Worm   280 --------GTYRSGTDQS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 46/117 (39%)
asd-2NP_001250340.1 STAR_dimer 95..145 CDD:374616 10/48 (21%)
SF1_like-KH 161..283 CDD:239088 46/133 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1833
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.