DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and fubl-3

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_510825.1 Gene:fubl-3 / 181773 WormBaseID:WBGene00016489 Length:641 Species:Caenorhabditis elegans


Alignment Length:183 Identity:36/183 - (19%)
Similarity:73/183 - (39%) Gaps:33/183 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELRSDPR 145
            |.||..::.:|.|:      .|.|:|..|..:|:|:..|.|.:.|...:::.|..|..::..||:
 Worm   154 PSKITIEIPIPANK------CGAIIGKGGEQMRKLRSWTNCNVQLLQDNNIADTVKPLKITGDPK 212

  Fly   146 YAHLQKNLFLE-------------------VSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSH 191
            .....:.|..:                   |:|:::..:.......|:..::...|...:||.. 
 Worm   213 QVEQCRLLVADILACNDDTPASAMMAGNGPVATMSLQVKVPRCTVGAIMGLQGKNIKKLSDETG- 276

  Fly   192 EQLRELMEIDPESAKNFKGLNLEAYRSVRDSNGASKYINLIKRVAENPSKVAD 244
            .:::.|.:.||:       |...:...:.:.|.......|||.:.|..|:.|:
 Worm   277 TKIQFLPDDDPK-------LMERSLAIIGNKNKVYVCAQLIKAIVEANSEAAN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 23/134 (17%)
fubl-3NP_510825.1 KH-I 59..118 CDD:238053
KH 155..225 CDD:197652 18/75 (24%)
KH-I 247..311 CDD:238053 10/71 (14%)
KH-I 330..390 CDD:238053
DUF1897 586..621 CDD:286140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.