Sequence 1: | NP_611610.2 | Gene: | CG4021 / 37484 | FlyBaseID: | FBgn0034659 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001360614.1 | Gene: | nova-1 / 180183 | WormBaseID: | WBGene00013347 | Length: | 417 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 40/202 - (19%) |
---|---|---|---|
Similarity: | 70/202 - (34%) | Gaps: | 55/202 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 KVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIAL-----------------KGR------ 128
Fly 129 --SSMRDRNKEE--ELRSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEV 189
Fly 190 SHEQLRELMEIDPESAKNFKGLNLEAYRSVRDSNGASKYINLIKRVAENPSKVADMEQVDYDYDE 254
Fly 255 HHMPPIH 261 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4021 | NP_611610.2 | SF1_like-KH | 86..202 | CDD:239088 | 24/141 (17%) |
nova-1 | NP_001360614.1 | PCBP_like_KH | 47..113 | CDD:239089 | 14/69 (20%) |
PCBP_like_KH | 139..208 | CDD:239089 | 14/79 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D590738at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |