DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and nova-1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001360614.1 Gene:nova-1 / 180183 WormBaseID:WBGene00013347 Length:417 Species:Caenorhabditis elegans


Alignment Length:202 Identity:40/202 - (19%)
Similarity:70/202 - (34%) Gaps:55/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIAL-----------------KGR------ 128
            |:.:|.|.      .|.|:|..|.::|.|:.:..|::.:                 |||      
 Worm    49 KILIPSNA------VGAIIGKGGEAMRNLKNDNNCRVQMSKNSETYPGTSERICLVKGRLNNIMA 107

  Fly   129 --SSMRDRNKEE--ELRSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEV 189
              .|::|:.:|:  :......:.|...:...|:..|.........|..:.|.|:..         
 Worm   108 VIESIQDKIREKCADQGGSDAFDHKNTSRGAEIKIVMPNTSAGMVIGKSGANIKDI--------- 163

  Fly   190 SHEQLRELMEIDPESAKNFKGLNLEAYRSVRDSNGASKYINLIKRVAENPSKVADMEQVDYDYDE 254
             .||....:::.|::.......:||...:|.... ||..:....||.|   |||.        |.
 Worm   164 -REQFGCQIQVYPKAGSVEAKTSLERVVTVAHDE-ASALLQAASRVLE---KVAS--------DP 215

  Fly   255 HHMPPIH 261
            ||...|:
 Worm   216 HHASEIN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 24/141 (17%)
nova-1NP_001360614.1 PCBP_like_KH 47..113 CDD:239089 14/69 (20%)
PCBP_like_KH 139..208 CDD:239089 14/79 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.