DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and sfa-1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_503033.1 Gene:sfa-1 / 178486 WormBaseID:WBGene00013808 Length:699 Species:Caenorhabditis elegans


Alignment Length:229 Identity:63/229 - (27%)
Similarity:113/229 - (49%) Gaps:39/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PSEITEEQPTTTHEYQPRLNEIAQKF-LAD--LDEERQRLSAEFPLC-----ALLIDEAR----- 58
            |:::||:| ...:..|..:.:..:|. |||  :.|.|:|..:..|:.     .|...|.|     
 Worm   209 PADLTEDQ-RNAYLLQLEIEDATRKLRLADFGVAEGRERSPSPEPVYDANGKRLNTREVRKRQEL 272

  Fly    59 -----DRVYATGRI-PGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQE 117
                 :::.|..:| |..:..|| ||...:::..||::|..|:|..||.|.::||:||:|:.|:.
 Worm   273 EQLRHEKIQALLKINPNFKPPAD-YRAPNIRLHDKVWIPQEQFPDLNFVGLLIGPRGNTLKSLEA 336

  Fly   118 ETQCKIALKGRSSMRDRNKEEEL-----RSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEI 177
            ||..||.::|:.|:::......|     .::|.:|::...   :::.:....|   :|...:||.
 Worm   337 ETGAKIIIRGKGSIKEGKLTNRLGPMPGENEPLHAYVTGT---DMNVIKKACE---KIKQVIAEA 395

  Fly   178 RKYLIPDNNDEVSHEQLRELMEID----PESAKN 207
            .  .:|||| |:...|||||..::    ||...|
 Worm   396 T--ALPDNN-ELRKLQLRELALLNGTFRPEDLAN 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 37/124 (30%)
sfa-1NP_503033.1 MSL5 185..422 CDD:227503 60/223 (27%)
PTZ00368 <427..>471 CDD:173561 63/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.