DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and Khsrp

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001382025.1 Gene:Khsrp / 171137 RGDID:621828 Length:748 Species:Rattus norvegicus


Alignment Length:62 Identity:16/62 - (25%)
Similarity:33/62 - (53%) Gaps:9/62 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDP 144
            :|::.:|..:      ||.::|..|.::::|||....|:.|. :...::.|.::.||  .||
  Rat   236 VQEIMIPAGK------AGLVIGKGGETIKQLQERAGVKMILI-QDGSQNTNVDKPLRIIGDP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 16/61 (26%)
KhsrpNP_001382025.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..148
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..422
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..570
4 X 12 AA imperfect repeats 572..685
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 588..650
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..678
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.