DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and Sf1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_038936270.1 Gene:Sf1 / 117855 RGDID:620645 Length:641 Species:Rattus norvegicus


Alignment Length:211 Identity:50/211 - (23%)
Similarity:94/211 - (44%) Gaps:48/211 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKMENPSEI--TEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYAT 64
            ::..:|..|  :|.:...|.|::.|         ..|:|||..|..|  :.||            
  Rat    80 DRSPSPEPIYNSEGKRLNTREFRTR---------KKLEEERHTLITE--MVAL------------ 121

  Fly    65 GRIPGKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRS 129
              .|..:..|| |:....::..||.:|.::||:.||.|.::||:||:|:.:::|...||.::|:.
  Rat   122 --NPDFKPPAD-YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKG 183

  Fly   130 SMRD----RNKEEELRSDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYL-----IPDN 185
            |:::    |...:.|..:....|           ..:.|.....:..|:.:||..|     .|::
  Rat   184 SVKEGKVGRKDGQMLPGEDEPLH-----------ALVTANTMENVKKAVEQIRNILKQGIETPED 237

  Fly   186 NDEVSHEQLRELMEID 201
            .:::...|||||..::
  Rat   238 QNDLRKMQLRELARLN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 32/125 (26%)
Sf1XP_038936270.1 MSL5 19..259 CDD:227503 50/211 (24%)
ZnF_C2HC 280..295 CDD:197667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.