DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and KHDRBS1

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_006550.1 Gene:KHDRBS1 / 10657 HGNCID:18116 Length:443 Species:Homo sapiens


Alignment Length:205 Identity:76/205 - (37%)
Similarity:123/205 - (60%) Gaps:10/205 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PSEITEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVY-ATGRIPGK 70
            |:.:.....|.:.:.:|.     .|:|.:|..|:..|...|.....|:....:::. ...:...:
Human    83 PTPLLPPSATASVKMEPE-----NKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDE 142

  Fly    71 ELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRN 135
            |.|.|::..|.||:.::|.:||.|||||||.||||||:||:::||||||..||::.|:.||||:.
Human   143 ENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKA 207

  Fly   136 KEEELR--SDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRELM 198
            ||||||  .||:||||..:|.:.:.....|.|.::.:|:|:.|::|:|:||..|::..||..||.
Human   208 KEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELS 272

  Fly   199 EID--PESAK 206
            .::  ||.::
Human   273 YLNGVPEPSR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 58/119 (49%)
KHDRBS1NP_006550.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 2/12 (17%)
Involved in homodimerization. /evidence=ECO:0000305|PubMed:26758068 100..260 66/164 (40%)
Qua1 102..153 CDD:406639 10/50 (20%)
KH-I_KHDRBS1 152..257 CDD:411896 54/104 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..316 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..346
Interaction with HNRNPA1. /evidence=ECO:0000269|PubMed:17371836 351..443
Sam68-YY 366..415 CDD:406871
Interaction with ZBTB7A. /evidence=ECO:0000269|PubMed:24514149 400..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8456
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.