Sequence 1: | NP_611610.2 | Gene: | CG4021 / 37484 | FlyBaseID: | FBgn0034659 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006550.1 | Gene: | KHDRBS1 / 10657 | HGNCID: | 18116 | Length: | 443 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 76/205 - (37%) |
---|---|---|---|
Similarity: | 123/205 - (60%) | Gaps: | 10/205 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PSEITEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVY-ATGRIPGK 70
Fly 71 ELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRN 135
Fly 136 KEEELR--SDPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRELM 198
Fly 199 EID--PESAK 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4021 | NP_611610.2 | SF1_like-KH | 86..202 | CDD:239088 | 58/119 (49%) |
KHDRBS1 | NP_006550.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..96 | 2/12 (17%) | |
Involved in homodimerization. /evidence=ECO:0000305|PubMed:26758068 | 100..260 | 66/164 (40%) | |||
Qua1 | 102..153 | CDD:406639 | 10/50 (20%) | ||
KH-I_KHDRBS1 | 152..257 | CDD:411896 | 54/104 (52%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 280..316 | 0/3 (0%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 327..346 | ||||
Interaction with HNRNPA1. /evidence=ECO:0000269|PubMed:17371836 | 351..443 | ||||
Sam68-YY | 366..415 | CDD:406871 | |||
Interaction with ZBTB7A. /evidence=ECO:0000269|PubMed:24514149 | 400..420 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 411..443 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165155064 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5176 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D428083at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm8456 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11208 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.810 |