DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and khdrbs3

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_009296555.1 Gene:khdrbs3 / 101867535 ZFINID:ZDB-GENE-130530-892 Length:305 Species:Danio rerio


Alignment Length:234 Identity:79/234 - (33%)
Similarity:116/234 - (49%) Gaps:43/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRDRNKEEELR--SDPRYAHLQKNLFLE 156
            |..:|||.||:|||:||||:||||:|..|:::.|:.||||:.||||||  .:.:|.||.::|.:.
Zfish    30 QQTQFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKEKEEELRKSGETKYHHLNEDLHVL 94

  Fly   157 VSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRELMEID--PESAK--------NFKGL 211
            :...|.|||.::|:.:||.||:|:||||.|||:...||:||..::  .|.||        ..:|.
Zfish    95 IEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSEDAKVPAARGKTTTRGR 159

  Fly   212 NLEAYRSVRDSNGASKYINLIKRVAENPSKVADMEQVDYDYDEHHMPPIHLPTGYEYSIQRPSKI 276
            ...|..:.|...|..            |.:.|    |.........||..:|:      .|...:
Zfish   160 GTSAPGTHRTRGGVP------------PPQAA----VPRGAAPRGAPPSRVPS------SRGVAV 202

  Fly   277 VAKFKRPYPYPTDMKPVREPPIKF------YKPNPGIGT 309
            .::..|..|.|...:|   ||...      |:.:.|.||
Zfish   203 SSRRARGAPPPPGYRP---PPAVVQDTYGEYEYDDGYGT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 55/111 (50%)
khdrbs3XP_009296555.1 SF1_like-KH 34..141 CDD:239088 54/106 (51%)
Sam68-YY 227..279 CDD:293176 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.