DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4021 and khsrp

DIOPT Version :9

Sequence 1:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001123831.2 Gene:khsrp / 100170586 XenbaseID:XB-GENE-493317 Length:675 Species:Xenopus tropicalis


Alignment Length:282 Identity:54/282 - (19%)
Similarity:88/282 - (31%) Gaps:116/282 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PG------KELYADVY---RQKPMKIIQKVFVPVNQYPKFNFAGK-------------------- 103
            ||      |:.:||..   ||...||..:....||..|:|||.|:                    
 Frog     5 PGAQTGNRKDAFADAVQRARQIAAKIGGEATGGVNNTPEFNFGGQKRQLEDGDVFGFPSPDQPEC 69

  Fly   104 --------------------------------------ILGPKGNSLRRLQEETQCKIALKGRS- 129
                                                  |:|..|..:.::|:|:.||:.:...| 
 Frog    70 KKLATQPEPIPPPLAPVHPPRSSSMTEEYRVPDGMVGLIIGRGGEQINKIQQESGCKVQISPDSG 134

  Fly   130 SMRDRNKEEELRSDPRYAHLQKNLFLEVSTVA-----IPAECHSRIAYALAEIRKYLIPDNNDEV 189
            .|.:|  ...|...|  ..:||...|....||     .|::.|                 :|...
 Frog   135 GMPER--VVSLTGSP--DSVQKAKMLLDDIVARGRGGPPSQFH-----------------DNSNG 178

  Fly   190 SHEQLRELMEIDPESAKNFKGLNLEAYRSVRDSNG--------ASKYINLIK--RVAENPSKV-- 242
            .:..|:|:| |....|....|...|..:.:::..|        .|:..|:.|  |:...|.||  
 Frog   179 QNGSLQEIM-IPAGKAGLIIGKGGETIKQLQERAGVKMILIQDGSQNTNMDKPLRIVGEPFKVQQ 242

  Fly   243 ---------ADMEQVDYDYDEH 255
                     .:.:|.::|.:|:
 Frog   243 ACEMVMDLLRERDQANFDRNEY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 31/179 (17%)
khsrpNP_001123831.2 KH-I 95..157 CDD:238053 14/65 (22%)
KH-I 184..248 CDD:238053 14/64 (22%)
KH-I 277..338 CDD:238053
KH_1 377..442 CDD:278442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D590738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.