DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and PRM4

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_015169.1 Gene:PRM4 / 855947 SGDID:S000006077 Length:284 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:29/136 - (21%)
Similarity:53/136 - (38%) Gaps:32/136 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TVVSTL--QRPTLYVSMDSSHAQF-----VRDTISGNKVVIFSKSYCPYCSMAKEQFRK------ 54
            |..:||  :..:|.:..:..|.:|     ..|.|..:..|:|.||     |.|...|.|      
Yeast   131 TTTTTLNPRSSSLALQKNCDHKKFDPRTDFLDIIRTSPAVLFIKS-----SQADSIFLKNLLQRE 190

  Fly    55 --INVKATVIELDQRDDGNEIQAVLGE---------MTGSRTVPRCFIDGKFV---GGGTDVKRL 105
              |:.:...::|::...|.|::..:.:         ...|...|..|::|..|   |...|:...
Yeast   191 FEISPELATVDLEKHSHGYELEKYIKQNKLNIDTSAALESIQSPYLFLNGISVINRGMVRDIIEP 255

  Fly   106 YEQGIL 111
            :.:|:|
Yeast   256 HSKGLL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 21/99 (21%)
PRM4NP_015169.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.