DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and GRX2

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_010801.1 Gene:GRX2 / 852124 SGDID:S000002921 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:44/117 - (37%)
Similarity:70/117 - (59%) Gaps:11/117 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQRPTLYVSMDSSHAQFVRDTISGNKVVIFSKSYCPYC-SMAKEQFRKINV---KATVIELDQRD 68
            |..|.:......:|   |:|.|...:|.:.:|:||||| :.....|:::||   ||.|:|||:..
Yeast    30 LSTPKMVSQETVAH---VKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMS 91

  Fly    69 DGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQG----ILQKYFQ 116
            :|:|||..|.|::|.:|||..:|:||.:||.:|::.|.:.|    ||:..||
Yeast    92 NGSEIQDALEEISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILKPVFQ 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 36/87 (41%)
GRX2NP_010801.1 GRX_GRXh_1_2_like 53..137 CDD:239511 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346389
Domainoid 1 1.000 60 1.000 Domainoid score I2556
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1596
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53522
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - mtm9249
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
TreeFam 1 0.960 - -
1312.690

Return to query results.
Submit another query.