DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and GRX6

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_010274.1 Gene:GRX6 / 851551 SGDID:S000002168 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:39/132 - (29%)
Similarity:61/132 - (46%) Gaps:28/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQRPTLYVSMDSSHAQFVRDTISGNK-------------------VVIFSKSYCPYCSMAKE--- 50
            ||:|  ..|:|.|.:....|  .|::                   ::|||||.|.|....||   
Yeast    87 LQQP--IASVDDSLSAIKND--KGSRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLE 147

  Fly    51 -QFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQGILQKY 114
             :::.| ....:||||:...|.|:|..:..:||..|||...::|...||..::|:|:.||.|.:.
Yeast   148 NEYQFI-PNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLES 211

  Fly   115 FQ 116
            .|
Yeast   212 LQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 30/102 (29%)
GRX6NP_010274.1 GRX_GRXh_1_2_like 127..210 CDD:239511 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 1 1.100 - - O PTHR45694
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.