DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and GRX8

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_013468.3 Gene:GRX8 / 851079 SGDID:S000004356 Length:109 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:27/101 - (26%)
Similarity:45/101 - (44%) Gaps:15/101 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MDSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELD----QRDDGNEIQAVL 77
            |..||..|.           .|.|:||.|..|...:.|:||:..|...|    .|::..:.:...
Yeast    11 MIKSHPYFQ-----------LSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKWRIAF 64

  Fly    78 GEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQGILQK 113
            .::.|||.:|...::|||.|..:.:.|...:|.|::
Yeast    65 QKVVGSRNLPTIVVNGKFWGTESQLHRFEAKGTLEE 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 23/83 (28%)
GRX8NP_013468.3 GrxC 21..99 CDD:223767 22/77 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1664
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.720

Return to query results.
Submit another query.