DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and GRX1

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_009895.1 Gene:GRX1 / 850322 SGDID:S000000540 Length:110 Species:Saccharomyces cerevisiae


Alignment Length:96 Identity:39/96 - (40%)
Similarity:60/96 - (62%) Gaps:4/96 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRDTISGNKVVIFSKSYCPYCSMA-KEQFRKINV---KATVIELDQRDDGNEIQAVLGEMTGSRT 85
            |:|.|:.|::.:.||:|||||..| ...|.|:.|   |..|::|:...:|.:|||.|.|:.|.||
Yeast    10 VKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRT 74

  Fly    86 VPRCFIDGKFVGGGTDVKRLYEQGILQKYFQ 116
            ||..:|:||.:||..|::.|.|.|.|::..:
Yeast    75 VPNIYINGKHIGGNDDLQELRETGELEELLE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 35/83 (42%)
GRX1NP_009895.1 GRX_GRXh_1_2_like 19..92 CDD:239511 31/72 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346390
Domainoid 1 1.000 60 1.000 Domainoid score I2556
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1596
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53522
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - mtm9249
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
TreeFam 1 0.960 - -
1312.690

Return to query results.
Submit another query.