DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and AT1G77370

DIOPT Version :9

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001321328.1 Gene:AT1G77370 / 844073 AraportID:AT1G77370 Length:156 Species:Arabidopsis thaliana


Alignment Length:121 Identity:47/121 - (38%)
Similarity:65/121 - (53%) Gaps:26/121 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQR---------------- 67
            :|.:.||::.|..||:|||||||||||..:|..|.::..:..|:|||||                
plant    31 NSVSAFVQNAILSNKIVIFSKSYCPYCLRSKRIFSQLKEEPFVVELDQRGITFFLTQLFMRIELF 95

  Fly    68 ----------DDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGTDVKRLYEQGILQK 113
                      :||::||..|.|..|.||||:.|::||.:||..|:....|.|.|||
plant    96 LKTSERFVFAEDGDQIQYELLEFVGRRTVPQVFVNGKHIGGSDDLGAALESGQLQK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 40/105 (38%)
AT1G77370NP_001321328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2990
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2092
OMA 1 1.010 - - QHG53522
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - mtm1143
orthoMCL 1 0.900 - - OOG6_100315
Panther 1 1.100 - - O PTHR45694
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.