powered by:
Protein Alignment Grx1t and AT1G06830
DIOPT Version :9
Sequence 1: | NP_611609.1 |
Gene: | Grx1t / 37483 |
FlyBaseID: | FBgn0034658 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_172168.1 |
Gene: | AT1G06830 / 837195 |
AraportID: | AT1G06830 |
Length: | 99 |
Species: | Arabidopsis thaliana |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 38/73 - (52%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 VVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGG 98
||||:||.|......:..|:.:.|...:.|:|:..:..||:..|..:..|:.||..||.||.||.
plant 13 VVIFTKSSCCLSYAVQVLFQDLGVNPKIHEIDKDPECREIEKALMRLGCSKPVPAVFIGGKLVGS 77
Fly 99 GTDVKRLY 106
..:|..::
plant 78 TNEVMSMH 85
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0695 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.770 |
|
Return to query results.
Submit another query.